SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000026 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000026
Domain Number 1 Region: 209-346
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-33
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 2 Region: 349-489
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-30
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 3 Region: 927-1071
Classification Level Classification E-value
Superfamily C-type lectin-like 2.75e-28
Family C-type lectin domain 0.0039
Further Details:      
 
Domain Number 4 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.46e-26
Family Cysteine rich domain 0.0058
Further Details:      
 
Domain Number 5 Region: 1503-1638
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-22
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 6 Region: 636-793
Classification Level Classification E-value
Superfamily C-type lectin-like 2.84e-21
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 7 Region: 500-626
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-18
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 8 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 2.26e-16
Family Fibronectin type II module 0.0014
Further Details:      
 
Domain Number 9 Region: 1217-1334
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-16
Family C-type lectin domain 0.0055
Further Details:      
 
Domain Number 10 Region: 1085-1145
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000000304
Family C-type lectin domain 0.0085
Further Details:      
 
Domain Number 11 Region: 803-917
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000531
Family C-type lectin domain 0.029
Further Details:      
 
Domain Number 12 Region: 1429-1494
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000107
Family C-type lectin domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000026   Gene: ENSTTRG00000000026   Transcript: ENSTTRT00000000029
Sequence length 1699
Comment pep:novel genescaffold:turTru1:GeneScaffold_1444:106971:203815:-1 gene:ENSTTRG00000000026 transcript:ENSTTRT00000000029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRWATPLRAAELLVLLLPCFGLVEPSDRSGNDSFTIVNENTGKCITPLNDWIVAKDCD
ETKDMLWKWVSQHRLFHLQSQKCLGLDITKPVDTLRMFSCDSNAMLWWKCEHHSLYGAAQ
YRLTLKGGHAIASTNSSDVWKKGGSEENLCAQPYHEIYTRDGNSYGRPCEFPFLVNGTWH
HECIHDGDRSGPWCATTLNYEYDQKWGICLQPENGCEDNWEKKEEMGSCYQFNTQATLSW
KEAYVSCQNQGADLLSINSAAELTYLTEKEGIPRIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDVPSAPIIDRSSCARMDADSGLWQSFSCEAQLPYVCKKLLNNTVELTDVWTYSDTR
CDAADWLPNNGFCYLLVNESDSWDKAHMKCKTFSSDLISIHSLADVELIVTELHNGDAKE
EVWTGLRNINTPTLFQWSDGTEVTLTYWDENEPHVPYNKTPNCVSYLGKLGQWKVQSCEE
KLKYVCKKKGEKLNDTRSDKMCPPDEGWKRHGEACYKIYKDEVPFGTNCNLTVTSRFEQE
YLNDMIKKYTKSPEKYFWTGLRDTDASGEYSWGSAGGIKRAVTFSNWNFLEPASPGGCVA
MATGKSLGKWEVKDCRSFRALSICKKISEHPEPEKAAPKPEDPCPEGWHSFPSGLSCYKL
FHIERIVRKRNWEEAERFCQALGGHLPSFSHMDEIKKFLHFLTDQFSDQRWLWIGLNKRS
PDLQGSWQWSDHTPXXXXXXXXXXXXXXXXXXXXXXXVINRPWRRRWYFYDDREFIYLRP
FACDTKLEWMCQIPKGRTPKMPDWYNPERAGIHGPPVVIEGSEYWFVADPRLNYEEAVLY
CASNHSSLASVTSFAGLRAIKNKIANISGDEEKWWVRTTDQLIERRFLSSRHPFHHFPIT
FGEECFYLSAKTWFSVEKYSPDSAAKIQCSGDWITFQNKCFLRIKPKSLTFSEASDTCHT
YGGTLPSVLSQREQDFITSLLPDMEATLWIGLRWTAYEKINKWMDNRELTYSNFHPLLVG
RRLRIPTNIFDEEGSYHCALMLNLQKSPFTGTWNFTSCSEHHTLSLCQKYSEIESRQTLQ
NTSETVKYQNNLYKIMLKTLTWTDALKECQKENMQLVSITDPYQQAFLTVQAVLHNTSLW
IGLSSHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXETEKEVKPVNSVRCPSPVLNTPWIPFENSCYNFMITKNRYIVTTRDEVHSQCQTLNP
KSHILSIRDEKENNFVLEQLLRYHYMASWVMLGITYENNSLMWSDKTTLSYTHCRSGRPA
VKNDKFFAGLNTDGFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYKEDYNTTLPRFIPH
EGGIYNVIKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLWVGLSSHDG
SESSFEWSDGSAFDYIPWKDKKSAGNCVVLDPKGIWKHEKCNSVKDGAICYKPTKSKEVS
SPTYSSRCPAVKGNKSQWIQYRDHCYTSDQALHSFSEARRFCSELDHSATIVTIKDEDEN
KFVSRLMRENNNITMRVWLGLSQLSADQSWNLYGSKVTFVKWANNHNSGNGQCTILISSN
DTWIKVECSRGYGRVVCRAPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNRLHWVGFS
SVRYQQGVNEDEIMLSLHD
Download sequence
Identical sequences ENSTTRP00000000026 ENSTTRP00000000026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]