SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000132 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000132
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 6.73e-62
Family Alanine racemase-like, N-terminal domain 0.000000125
Further Details:      
 
Domain Number 2 Region: 248-415
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 7.53e-35
Family Eukaryotic ODC-like 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000132   Gene: ENSTTRG00000000140   Transcript: ENSTTRT00000000140
Sequence length 447
Comment pep:known_by_projection scaffold:turTru1:scaffold_110799:69760:80453:-1 gene:ENSTTRG00000000140 transcript:ENSTTRT00000000140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNIVA
QIKPFYTVKCNSTPAVLEILAALGTGFACSNKTEMALVQELGVSPENIIYISPCKQVSQI
KYAAKVGVNIMTCDNEVELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHL
LECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDVYFPEGSGIKIISEPGSYYVSSAFTLAVNIIAKKVVENKFSSG
VGKTGSDEPTFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDEL
DQIVENCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSYSDWYEMQDAGIT
SDTMMKNFFFVPSCIQLSQEDNFSTEA
Download sequence
Identical sequences ENSTTRP00000000132 NP_001278441.1.21590 NP_001278442.1.83887 NP_001288668.1.21590 NP_001288669.1.83887 XP_019780578.1.83887 XP_019780579.1.83887 XP_019780580.1.83887 ENSTTRP00000000132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]