SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000215 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000215
Domain Number 1 Region: 494-719
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-59
Family Eukaryotic proteases 0.00000000474
Further Details:      
 
Domain Number 2 Region: 114-208
Classification Level Classification E-value
Superfamily Kringle-like 1.91e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 209-293
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-33
Family Kringle modules 0.00023
Further Details:      
 
Domain Number 4 Region: 301-385
Classification Level Classification E-value
Superfamily Kringle-like 2.39e-31
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 5 Region: 380-476
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-28
Family Kringle modules 0.00042
Further Details:      
 
Domain Number 6 Region: 35-124
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.06e-21
Family Hairpin loop containing domain 0.0000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000215   Gene: ENSTTRG00000000231   Transcript: ENSTTRT00000000231
Sequence length 727
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_77:308198:391945:-1 gene:ENSTTRG00000000231 transcript:ENSTTRT00000000231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPVLLLQHVLLHLLFPIAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIKT
KKMNTTDQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYEN
KDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPR
GEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTPH
RHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDLDTPWEYCAIKMCAHSTMNDTDVPME
TTECIQGQGEGYRGIINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGAE
SPWCFTTDPNIRVGYCSQIPKCDVSSGQYCYRGNGKNYMGNLSKTRSGLTCSMWDKNMED
LHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLD
HPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRDL
KDYEAWLGIHDVHGRGDEKRKQVLNVTQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLPN
YGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEICAGA
ENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIIL
TYKVPQS
Download sequence
Identical sequences ENSTTRP00000000215 ENSTTRP00000000215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]