SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000227 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000000227
Domain Number - Region: 2-75
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0769
Family Voltage-gated potassium channels 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000227   Gene: ENSTTRG00000000243   Transcript: ENSTTRT00000000243
Sequence length 90
Comment pep:novel scaffold:turTru1:scaffold_114760:52635:56077:1 gene:ENSTTRG00000000243 transcript:ENSTTRT00000000243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVFLRVFIEGXXXXFSDIFNSLDAAIIVVTLLVNIACIFYDFKVLKDFPKSTIILRPLR
LITLIRVFHLAHQKRHEMLTRRMVSGNKRR
Download sequence
Identical sequences ENSTTRP00000000227 ENSTTRP00000000227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]