SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000283 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000283
Domain Number 1 Region: 609-850,965-1083
Classification Level Classification E-value
Superfamily RNI-like 8.51e-61
Family 28-residue LRR 0.001
Further Details:      
 
Domain Number 2 Region: 36-126
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-23
Family Pyrin domain, PYD 0.0094
Further Details:      
 
Domain Number 3 Region: 203-292,319-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000436
Family G proteins 0.043
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000283
Domain Number - Region: 490-530,605-621
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0844
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000283   Gene: ENSTTRG00000000301   Transcript: ENSTTRT00000000301
Sequence length 1121
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2965:35026:64763:1 gene:ENSTTRG00000000301 transcript:ENSTTRT00000000301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVTFPTGPICFLPKNLLLQQNLSSQPCVKMGEAKLSSFSSYGLQWCFKQLHKEEFQIFKA
LLKESASEPAACSFPLVEVDNADSEQLTSLLHEHYKESLAWKISIDIFEKMSLSALSEMA
RDEMKKYLLAEIPEHSTPTKTDQGLSMEEVPSHRDDQQDYKSHVMRKFSTKLDAHHSFEK
FASDCPDVHVLLGAFNPDQGGFRPLTVVLHGKAGIGKSALARRILLFWAQGELYQGMFSY
VFFLHAREVQRTRECSFAELISRQWPDTQVQVEEILSQPERLLFVVDGFEDLDLAFKDDD
SNLSGDWAEKQPVSVLMHSLLKKVLLPESSLIITVRDSGIEKLQSVLLSPHYLLVGGLSV
EKRMQLLLEHMKHEHQKMQTLRSVVGNHEVFDKCQVSVVCSLVCEALNLQEAPGKSLSIT
CQTLTGLYASFVFHQLAPKDAVRSCLRQEERVTLKGLCQMAVEGVWNTKFVFYSDDLGIH
GLKEPELSALFHTSILLQGSRCEECYMFLHLSLQEFFAALYYVLEGWEGEGDPYPLFTEN
VKSLMELKQIDFNVHLVQMKRFLFGLMSKEVMGALGTLLGSPVPLVAKQRLLHWISLLGQ
HTNTTAPLDFLDAFYCLFETQDDEFVRSALNSFQEVWLPLNRPMDLIVSSFCFRHCQYLR
KIRLDVREVPKHEFAESWPSIPQGLQIKTHDEHWEHLCSVLSTHPNLRQLDLSGSILSEE
AMKTLCIKLRQPTCKIQNLIFTGAQITPGLRHLWLTLINRNIKYLDLESTHLKDRDVMMA
CEAVKHPSCLLESLRLDHCELTHTCCQVIAQMLVTSISLKSLSLAGNKVTDQSIKSLCDA
LKVTQCTLQKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSC
LLQDLELVKCRLTAACCKNLSYVITRSQHLKSLDLAANALGDHGIAALCEGLQKNSLRRL
GLETCGLTSNGCEALSSALSCNQHLTSLNLMQNNFGPRGMTKLCSAFAQPTSNLQTIGLW
KWQYPARIRRLLEELERLKPHIVIGDGWYSFAEDDRYWWKN
Download sequence
Identical sequences ENSTTRP00000000283 ENSTTRP00000000283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]