SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000398 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000398
Domain Number 1 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-22
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-21
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000398   Gene: ENSTTRG00000000425   Transcript: ENSTTRT00000000425
Sequence length 499
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_821:140329:175317:-1 gene:ENSTTRG00000000425 transcript:ENSTTRT00000000425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI
LQIVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTAIFILWGVLVHLVIPPF
VFMVTEEWDYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVAGGAASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTGGGGERVPGPGLGPQGGGLTALPTSLTPLVVYSKNRVPSLEEVSQ
TLRSKGHVSRPPGEEAGAGPPEEGSPTSEVLINQLDRISEEGEPWDAQDYHPLIFQNVSI
TFVNEEAGLSDEDTSKSSLEDNLAGEERPQEGATAEVPLNLGEFPSSDESTFTSTESELS
VPYEQLMNEYNKANCPKGT
Download sequence
Identical sequences XP_004267691.1.21590 XP_019805482.1.83887 ENSTTRP00000000398 ENSTTRP00000000398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]