SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000461 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000461
Domain Number 1 Region: 28-509
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-145
Family ALDH-like 0.0000000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000461   Gene: ENSTTRG00000000490   Transcript: ENSTTRT00000000492
Sequence length 513
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1684:95508:124282:-1 gene:ENSTTRG00000000490 transcript:ENSTTRT00000000492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLRAGTAGLSPLRHTLRPVLVAAMSTGTFIVSQPLNYRSGARFGSVDASGTEKALEPAS
GRVIATFTCSGEEEVNLAIQDAKAAFKIWSQKSGMERCRILLEAARIIRDRKDEIATVET
INNGKSIFEARWDIDTSWQCLEYYAGLAGSMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIACWKSAPALACGNAMVFKPSPFTPVSTLLLAEIYTEAGVPPGLFNVVQGGAATG
QFLCQHRDVAKVSFTGSVPTGSKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMKNAVKGA
LMANFLTQGEVCNGTVFVKEILDQFSEEVKQTRIKXXXXXXXXXXXXXXXXXXXXXXXXX
FVKVAKEQGAKVLCGGDLYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILS
FDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAALQAGMCFINNYNVSPVELPFGGYK
KSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
Download sequence
Identical sequences ENSTTRP00000000461 ENSTTRP00000000461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]