SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000559 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000559
Domain Number 1 Region: 363-419,488-694
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.04e-40
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 79-108,137-398
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.33e-37
Family WD40-repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000559   Gene: ENSTTRG00000000590   Transcript: ENSTTRT00000000595
Sequence length 946
Comment pep:known_by_projection scaffold:turTru1:scaffold_112804:67091:105012:-1 gene:ENSTTRG00000000590 transcript:ENSTTRT00000000595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKCTEDSLRSRDWQRGPEAGTRQRIVPRDAESLGARFPLGLEPRGNPTAEAMERSAGDRT
ASALFAGFRALGLFSNDIPHVVRFSALKRRFCVTTCVGKSFHTYDVQKLSLVAVXXXXXX
XXXXXXXXXXXXXXXYGNVFSAFARNKEVVHTFKGHKAEIHLLQPFGDHVISVDTDGILI
IWHIYSEEEYLQLSFDKSVFKISAILHPSTYLNKILLGSEQGSLQLWNVKSNKLLYTFAG
WKVGVTALQQAPAVDVVAVGLMSGQIIIHNIKFDETLMKFRQDWGPITSISFRTDGHPVM
AAGSPCGHIGLWDLEDKKLINQMRNAHSTAIAGLTFLHREPLLVTNGADNALRIWIFDGP
TGEGRLLRFRMGHSAPLTKIRYYGQNGQQILSASQDGTLQSFSTIHEKFNKSLGHGLINK
KRVKRKGLQNTMSVRLPPITKFAAEEARESDWDGIIACHQGKLSCSTWNYQRSTIGAYFL
KPKELKKDDITATAVDITSCGNFAVIGLSSGTVDVYNMQSGIHRGSFGKDQAHKGSVRGV
AVDGLNQLTITTGSEGVLKFWNFKNKVLIHSVSLDSSPNMMLLHRDSGILGLALDDFSIT
VLDIETRKIVREFSGHQGQINDMAFSPDGRWLISASMDCSIRTWDLPSGCLIDSFLLDSA
PLNVTMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPTDYVPSVVMLPGTCQTQDV
ELLEETTEPSDEMIEYDSPEQLNEQLVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPK
SAPFFIPTVPGLVPRYAAPEQNSDPQQSKVVNLGILAQKSDFCLKLEEALVNNKYEAALN
LLKELGPSGIETELRSLSPDCGGSVEVMKSFLKMIRMMLDKKRDFELAQAYLALFLKLHL
KMLPSEPVLLEEMTKLSSQLEENWIHLQSLFNQSMCVLNYIKSALL
Download sequence
Identical sequences ENSTTRP00000000559 ENSTTRP00000000559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]