SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000623 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000623
Domain Number 1 Region: 575-678,789-904
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-49
Family Phosphate binding protein-like 0.0000316
Further Details:      
 
Domain Number 2 Region: 126-497
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.87e-22
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000623
Domain Number - Region: 667-765
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0381
Family Voltage-gated potassium channels 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000623   Gene: ENSTTRG00000000663   Transcript: ENSTTRT00000000662
Sequence length 1111
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2082:60541:210662:-1 gene:ENSTTRG00000000663 transcript:ENSTTRT00000000662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLSLWWLLSRVCLLLPPPCALVLAGVPGSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRTASRAPDGSRTGAQRDEPEPGTWRPPAPSPGARWLGSALYGRGPPGARKPGEGDRAE
TLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQGLGEMMELDLVSSVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLVLTQNNSKFHLGSIINITIN
LSSTEDLLSFLQVQLESVKNSTPTMVMFGCDMESIRRIFEITTQFGVAAPELHWVLGDSQ
NVEQLRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALIPSTMNCM
DVETANLTSGQYLSRFLANTTFRGLSGSIKVKGSTIISSENNFFIWNLQHDPLGKPMWTR
LGSWQQGKIIMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLDPMTNDSSILDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKLAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGELLSGSAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIAFMWPLHWMCWGIFVALHITAIFLTLYEWKSPFGMTKGRNRSKVFFSSALNVCY
ALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGIHDPK
LHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLDAFIM
DKALLDYEVSVDADCKLLTVGKPFAMEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLH
EKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCVGFGLSILTTIGEHIVYRLLLPRIK
NKSRLQYWLHTSQRLHRALNTSFVEEKRQRFKTKRVEKRSNVGPCQLTVWNTSNLSHDNR
RKYIFSDEGGQNQLSLRTHQDIPLPPRRRELPASLTTNGKADSLNGARNSVMQELSELEK
QIQVIQQELQLAVSRKTELEEYQRTNRTCEP
Download sequence
Identical sequences ENSTTRP00000000623 ENSTTRP00000000623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]