SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000650 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000650
Domain Number 1 Region: 450-564,683-823
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-65
Family Phosphate binding protein-like 0.00000000111
Further Details:      
 
Domain Number 2 Region: 247-429
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.35e-23
Family L-arabinose binding protein-like 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000650
Domain Number - Region: 533-678
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000942
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number - Region: 58-98
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.011
Family L-arabinose binding protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000650   Gene: ENSTTRG00000000691   Transcript: ENSTTRT00000000691
Sequence length 953
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2678:50680:242031:-1 gene:ENSTTRG00000000691 transcript:ENSTTRT00000000691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRTLLAQPGLWTRDTSWALLYFLCYVLPQTXXXXXXXXXXXXGIFETVENEPVNVEEL
AFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNVDNPHVSSIIEK
WSMERLQAPPRPGTGLLDGMMTTEAALMYDAVYIVAIASHRASQLTVSSLQCHRHKPWRL
GPRFMNLIKEAQWDGLTGRITFNKTDGLRKDFDLDIISLKEEGTEKVAGEVSKHLYKVWK
KIGIWNSNSGLNMTDGNKDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFE
GYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITY
VREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVI
ARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWW
FFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKIST
YEKMWAFMSSRQQTALVKNSDEGIQRVLTTDYALLMESTNIEYVTQRNCNLTQIGGLIDS
KGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIG
GIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQKGKSSRIRFYFRNKVRFHGRKKQSLGV
EKCLSFNAIMEELGISLKNQKKLKKKSRTKGKSSFTSILTCHQRRTQRKESVA
Download sequence
Identical sequences ENSTTRP00000000650 ENSTTRP00000000650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]