SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000658 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000658
Domain Number 1 Region: 231-688
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.09e-130
Family Aconitase iron-sulfur domain 0.000000000167
Further Details:      
 
Domain Number 2 Region: 728-960
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 7.85e-67
Family LeuD-like 0.0000000251
Further Details:      
 
Domain Number 3 Region: 13-136
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 5.89e-21
Family Aconitase iron-sulfur domain 0.00000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000658   Gene: ENSTTRG00000000698   Transcript: ENSTTRT00000000699
Sequence length 962
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1442:41785:86707:1 gene:ENSTTRG00000000698 transcript:ENSTTRT00000000699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPSAGYAFEYLIETLNDSSHKKFFNVPRLGGTKYDVLPYSIRVLLEAAVRNCDGFLMK
REDVMNILDWKTKQSNVEVPFFPARVLLQDGIPAMVDFAAMREAVKTLGGDPKKVHPACP
TDLTVDHSLQIDFNKCAIQNAPNPGGGDLQKAGKLSPLRVQPKKLPCRGQTTCRGSCDSG
ELGRNSGRFSSQIENTPILCPFHLQPVPXXXXXXXXXXXXXXXXXXXXXXXXWSSRVFKN
VAVIPPGTGMAHQVNLEYLSRVVFEEKDLLFPDSVIGTDSHITMVNGLGILGWGVGGIET
EAVMLGLPASLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQVGVAGKFVEFFGSGVS
QLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEHTGFDKAKLKSMETYLKAVKLFRND
QDNSREPEYPXXXXXXXXXXXXXXXXXXXXXXRVALTDMKSDFQACLYEKVGFKGFQIAA
EKQNDIVSIHYEGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEAGLHVKPY
IRTSLSPGSGMVTHYLSSSGVLPYLSKLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDL
VTCGVLSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQMEPLGTDPTGRNIYL
HDIWPSREEVHQIEEEHVVLSMFKALKEKTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXTKEPVALQPIENAHVLLYLGDSVTTDHISPAGSIARSSPAAKYLTNRGLTPREF
NSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTVHFPSGQTLDVFEAAELYQKEGIPL
IILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENADS
LGLSGRETFSLTFPEELSPGVTLNIKTSTGKVFSVIASFENDVEITLFKHGGLLNFVARK
FS
Download sequence
Identical sequences ENSTTRP00000000658 ENSTTRP00000000658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]