SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000781 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000781
Domain Number 1 Region: 643-828
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.28e-38
Family cAMP-binding domain 0.00053
Further Details:      
 
Domain Number 2 Region: 498-550,579-679
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-31
Family Voltage-gated potassium channels 0.0037
Further Details:      
 
Domain Number 3 Region: 12-77
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000169
Family Flavin-binding PAS domain 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000781   Gene: ENSTTRG00000000826   Transcript: ENSTTRT00000000828
Sequence length 1126
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_6:50134:82534:-1 gene:ENSTTRG00000000826 transcript:ENSTTRT00000000828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKFIIANARVENCAVIYCYYLFCELCGYSRAEVMHRPCTCDFLHGPRTQRRAAAQIAQAL
LGAEERKVEIAFYRKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXRAKTFRLKLPALLALTARDSSVRPGSARGAGAPGAVVVDMDLTPAAPS
IESLALDEVTAMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLAC
IWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVG
FGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRF
HQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGA
TKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIXXXXXXXXXXXXXKNDIFG
EPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTN
MIPGSPGSAELEGGFHRQRKRKLSFRRRTDRDPEQPGEVSALGPSRAGAGLSGRGRQGGP
WGESLSSGPSSPESSEDEGPGRSSSPLRLVPFSSPRPPGEPPGGDPLTEDGEKSSDTCNP
LSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPAPSLLNIPLSSPGRRPRGDVESRLDALQ
RQLSRLETRLSADMATVLQLLQRQVTLVPPAYSAVTTPGPGPTSTSPLLPVSPIPTLALD
SLSQVSQFMACEELPQDGPARRLSLPGQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences ENSTTRP00000000781 ENSTTRP00000000781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]