SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000825 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000825
Domain Number 1 Region: 162-324
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-26
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000825
Domain Number - Region: 341-429
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0122
Family Tyrosine-dependent oxidoreductases 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000825   Gene: ENSTTRG00000000874   Transcript: ENSTTRT00000000874
Sequence length 1131
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2257:5246:370064:-1 gene:ENSTTRG00000000874 transcript:ENSTTRT00000000874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDLESEVPPLPPRYRFRDLLLGDQGWQNDDRVQVEFYMNENTFKERLKLFFIKNQRSSL
RIRLFNFSLKLLSCFLYIIRVLLENPSQGNEWSHIFWVNRSLPLWGLQVSVALISLFETI
LLGYLSYKGNIWEQILRIPFILEVINAVPFIISIFWPSLRNLFVPVFLNCWLAKHALENM
INDLHRAIQRTQSAMFNQVLILISTLLCLIFTCICGIQHLERIGKKLNLFDSLYFCIVTF
STVGFGDVTPETWSSKLFVVAMICVALVVLPIQFEQLAYLWMERQKSGGNYSRHRAQTEK
HVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVLQIPMWSQRVIYL
QGSALKDQDLLRAKMDDAEACFILSSRCEVDRTSSDHQTILRAWAVKDFAPNCPLYVQIL
KPENKFHIKFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGQQSPEQWQKM
YGRCSGNEVYHIVLEESTFFAEYEGKSFTYASFHAHKKFGVCLIGIRREDNKNILLNPGP
RYIMSATDICFYINITKEENSAFKNHDHQKKSNVSRSFYHGPSRLPVHSIIASMGTVAID
LQDTSCRSASGPTLSLPSEGNKEVRRPSIAPVLEVADTSSLQTCDLLSDQSEDETTPDEE
MSSNVEYAKGYPPYSPYIGSSPTFCHLLHEKVPFCCLRLDKSCQHNYYEDAKAYGFKNKL
IIVAAETAGNGLYNFIVPLRAYYRPKKELNPVILLLDNPPDMHFLDAICWFPMVYYMVGS
IDNLDDLLRCGVTFAANMVVVDKESTMSAEEDYMADAKTIVNVQTLFRVSSLSITELTHP
ANMRFMQFRAKDCYSLALCKLEKKERXXXLAFMFRLPFAAGRVFSISMLDTLLYQSFVKD
YMISITRLLLGLDTTPGSGFLCSMKITEDDLWIRTYARLYQKLCSSTGDVPIGIYRTESQ
KLTTSESLISISVEEWEDTKDAKEQGHHRSNHRNSTSSDQSDHPLLRRKSMQWARRLSRK
GPKHSGKTAEKITQQRLNLYRRSERQELAELVKNRMKHLGLSTVGYDEMNDHQSTLSYIL
INPSPDTRLELNDVVYLIRPDPLAYLPNGEPSRKNSICNTTGQDSREETQL
Download sequence
Identical sequences ENSTTRP00000000825 ENSTTRP00000000825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]