SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001362 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001362
Domain Number 1 Region: 31-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.57e-88
Family Carbonic anhydrase 0.000000000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001362   Gene: ENSTTRG00000001445   Transcript: ENSTTRT00000001445
Sequence length 356
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_272:28931:89717:-1 gene:ENSTTRG00000001445 transcript:ENSTTRT00000001445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLRSLHAAAVLLLVVLKEQPSNPTPHNGSKWTYIGPDGETSWSKSYPLCGGLMQSPIDL
QDDILQYNASLVPLGFQGYSESANQQFVLTNNGHSVKLKLPKDMHIQGLGARYNASQLHL
HWGDENEPHGSEHTVGGKHFAAELHMVFYNSDLYPNASIASDKPEGLAVLAVLIEVGSFN
PSYDKIFSHLKDVKYKGQEVSIPGFSIEELLPKRPEEYYRYRGSLTTPPCYPTVLWTVFR
NPVEISQQQLTNLETALYCTRVEDPSPREMINNFRQVQKFDERLVYVSFRREGPDATYTG
PSLGIVLFVALAGVLGICIVLAVSIWLFRRKKSSKKVANKGVIYKPAIKQDAEAHV
Download sequence
Identical sequences ENSTTRP00000001362 ENSTTRP00000001362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]