SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001400 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001400
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 6.15e-45
Family Eukaryotic RPB5 N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 135-209
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 2.49e-30
Family RPB5 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001400   Gene: ENSTTRG00000001484   Transcript: ENSTTRT00000001484
Sequence length 210
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3283:195776:202677:-1 gene:ENSTTRG00000001484 transcript:ENSTTRT00000001484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDEEETYRLWKIRKNIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Download sequence
Identical sequences ENSTTRP00000001400 ENSTTRP00000001400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]