SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001468 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001468
Domain Number 1 Region: 1520-1717,1745-1770
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.77e-36
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1200-1355,1391-1470
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.06e-35
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 3 Region: 755-902,936-983
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-31
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 127-272,362-431
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.53e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001468
Domain Number - Region: 1779-1827
Classification Level Classification E-value
Superfamily EF-hand 0.00525
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001468   Gene: ENSTTRG00000001557   Transcript: ENSTTRT00000001558
Sequence length 1995
Comment pep:known_by_projection scaffold:turTru1:scaffold_113623:61520:140601:-1 gene:ENSTTRG00000001557 transcript:ENSTTRT00000001558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQALPVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKREQNNDDENKPKPNSDLEAGKN
LPFIYGDIPPGMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSNSAFETNTTSFFNGTRN
SNGTFVNVTMSTFNWKDYIEEEGHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQIKKQQEEAQAVAAAAAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNKGAGNRFPKSVSEDSVKRRFLFSMD
GNRLTSDKKFYSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDIGSENDFADDEHSTFE
DSESRRDSLFVPHRHGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCNGVVSLVGGPSA
LTSPTGQLPPEGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAMSIASILTNTMEELEES
RQKCPPCWYRFANVFLIWDCCDPWLKVKHVNLMDPFVDLPITICIVLNTLFMAMEHYPMT
GQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLMELGLANVE
GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFG
KSYKECVCKISSNCQLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLIVFM
LVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKNKIQEC
FQKTFFRKPKGIEIHEGNKIDSCVSNNTGIEISKELNYLKDGNGTTSGVGTGSSVEKYVI
DENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNAISSSEGSTVD
VALPREGEQAEIEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGKVWWNLRKTCYSIVEH
NWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKAFTYIFILEMLPQXXAYGFQ
TYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVV
NALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTTTGNMFEVSEVNNLSDCQ
ALGKKARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVKLQPVYEENLYMY
LYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQ
KPIPRPANKYQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQSKYMTLVLSRINLVF
IILFTGEFVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRL
ARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEAG
IDDMFNFETFGNSMICLFQITTSGGWDVLLAPILNSAPPDCDPDTIHPGSSVKGDCGNPS
VGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDAT
QFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVNGDRIHCLDILFAFTKRVLGESG
EMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLRQRLKTVLS
EYNKEAIKGRIDLPIKDDMIIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDKEKFGKDR
PEKESKGKEVRENQK
Download sequence
Identical sequences ENSTTRP00000001468 ENSTTRP00000001468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]