SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001516 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001516
Domain Number 1 Region: 241-341
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.88e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000778
Further Details:      
 
Domain Number 2 Region: 93-146
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000223
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.045
Further Details:      
 
Domain Number 3 Region: 14-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000236
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001516   Gene: ENSTTRG00000001609   Transcript: ENSTTRT00000001609
Sequence length 667
Comment pep:known_by_projection scaffold:turTru1:scaffold_99611:38952:67147:-1 gene:ENSTTRG00000001609 transcript:ENSTTRT00000001609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGLQRARSSTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHQLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLS
QLELIGHSIFDFVHPCDQEELQDALTPRQSLSKKKPEAPTERCFSLRMKSTLTSRGRTLN
LKAATWKVLHCSGHMRAYKPPAQSSPAGSPHLEPPLQCLVLICEAIPHPGSLEPPLGRGA
FLSRHSLDMKFTYCDERIAEVAGYSPDDLIGCSAYEYIHALDSDAVGQSIHTLLSKGQAV
TGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETEVVLSLEQTERHS
RRHVQRGTPSQKDAPNPGDSLDTSGPRILAFLHPPALSEAALAADPRRFCSPDLRRLLAP
ILDGTSVAATPSAPPAPRRPRSPLPADLPDELLVDVENAHKLFASGKDLEAVETDLDIAQ
DVDALDLEMLAPYISMDDDFQLNSSEQLPRAYHRPPGAVPRPRARSFHGMSPPTPEPSLL
PRWGSDPRLSCSSPSRGDPSASSPMAGARKRALAQSAEDEAEGVELLGVRPPKRSPSPEP
ENFLLPPLSLSFLLTGGPAPGSQQDPSTHLLELNEHLGPSLLSLYPDEDTAQPRSHFQPA
AGLAQAN
Download sequence
Identical sequences ENSTTRP00000001516 ENSTTRP00000001516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]