SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001518 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000001518
Domain Number - Region: 303-338
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0549
Family RILP dimerisation region 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001518   Gene: ENSTTRG00000001611   Transcript: ENSTTRT00000001611
Sequence length 523
Comment pep:known_by_projection scaffold:turTru1:scaffold_99611:95328:114186:-1 gene:ENSTTRG00000001611 transcript:ENSTTRT00000001611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRVPLPLRVGVACSAAGGYGSEKAGSWGGAGASAVEPLARRVVRGEATLAMDQPAGLQVD
YVFRGVEHAVRVMVSGQVLELEVEDRMTADQWRAEFDASFIEDLTHKTGNFKQFNIFCNM
LESALTQSSESVTLDLLTYTDLESLRNRKMGGRPGPLASRSAQLNSKRYLILIYSVEFDR
IHYPLPLPYQGKPDPVVLRGIIRSLKEELSRLRGLDGQDTRDSRETEIWHLREQVSRLSA
EKRELEAQLGRSREEALAGRAARQEVEALRGLVRGLELELRQERGLGHRGTGRRSQDCRR
LAKELEEVKASERSLRARLKTLNTELAMYKRGDRGGRGQGRPGRPSPSPTGGRVPRFDPT
AFVKAKEKKQRAIKMKQQQRNRLGSGGSGDRPSTSWSRQTRPPAAVTGRGDAANRSRNRS
SSVDSFRSRYSSASSCSEFEDFSESLPRGVRRRGKPPSPTTWRGSNTKPSPLERGRHQRR
LADSGGWVPIKEYSSDHQAADMAEIDARLKALQEYMNRLDVHS
Download sequence
Identical sequences ENSTTRP00000001518 ENSTTRP00000001518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]