SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001823 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001823
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 7.85e-34
Family VPS28 N-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 125-186
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 4.32e-20
Family VPS28 C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001823   Gene: ENSTTRG00000001941   Transcript: ENSTTRT00000001941
Sequence length 205
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2770:50957:53906:-1 gene:ENSTTRG00000001941 transcript:ENSTTRT00000001941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPDFEGRQTVS
QWVSLLSLPVSHPQAADLELHVSRR
Download sequence
Identical sequences ENSTTRP00000001823 ENSTTRP00000001823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]