SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001827 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001827
Domain Number 1 Region: 8-225
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.14e-32
Family Voltage-gated potassium channels 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001827
Domain Number - Region: 292-402
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000144
Family Potassium channel NAD-binding domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001827   Gene: ENSTTRG00000001945   Transcript: ENSTTRT00000001946
Sequence length 956
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3578:71793:189318:1 gene:ENSTTRG00000001945 transcript:ENSTTRT00000001946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNGYRYIGKFQVILVFVLSIGSLIIYFINSTDPFGSCSSYQDKTIPIDLTFNAFFSFYFG
LRFLAADDKVKFWLEMNSIVDIFTIPPTFISYYLKSNWLGLRFLRALRLLELPQILQILR
AIRTSNSVKFSKLLSIVLSTLFTAAGFIHLVENSGDPWLKGRNSQNISYFESIYLVMATT
STVGFGDVVAKTSLGRTFIMFFTLGSLVLFANCIPEMVELFGNKRKYTSSYEVVKGKKFI
VVCGNITVDSVTAFLRNFLRHKAGEINTEIVFLGEVPPSLELETIFKCYMAYTTFVSGSA
LKWEDLRRVAVDSAEACLIIANPLCSDSHAEDTSNIMRVLSIKNYYPNTRVIIQILQSHN
KVFLPKIPSWNWNTGDNIICFAELKLGFIAQGCLVPGLCTFLTSLFIEQNKKICPKEPWQ
KHFFSGLKNKILTQRLSDDFAGMSFPDVCRLCFVKMHLMLIAIEHKSVCHGYCGLILNPP
AQVKLRKNTLGFFIAESAKDVKRAFFYCAVCHSDVYTPELIGKCSCKSKNPRHKTVSESX
XXXXXXXXXXXXXPKVFSIINPCLISNXXXXXXXXXXHLLRQLDSSGMFHWCKATPLDKM
ILNRTEKSKHEFRNHIVACVFGDAHSTLMGLRNFVMPLRASSYTRQELKDIVFVGSLDYL
QREWRFLRNFPQIYILPGSALYSGDLHAVNIEECSMCAVLSSPSKSSSSPTLVDMEPIMA
TLNIRSLRISCSAQTPSKPPELPPSVCLYWLFPALSSLSHSXXXXXXXXXXXXXXXXXXX
XXXNPSNMHFIEQLGGMEGDLSGMSLHLSTSFATGTVFSGSFLDSLLATAFYNYHVLELL
QMLVTGGISSQLEQHLDKEKFCGPNDSYSTVSPGRMRCKLGLLALNQTILSDIQPRRTFG
QIFCGSLDNLGVLCLGLYRMIDEEERNPEHKRFVITRPENEFMLLHSDLVFCAIPF
Download sequence
Identical sequences ENSTTRP00000001827 ENSTTRP00000001827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]