SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001866 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001866
Domain Number 1 Region: 17-204
Classification Level Classification E-value
Superfamily Ribosomal protein S7 6.8e-63
Family Ribosomal protein S7 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001866   Gene: ENSTTRG00000001991   Transcript: ENSTTRT00000001990
Sequence length 204
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1069:40687:45204:1 gene:ENSTTRG00000001991 transcript:ENSTTRT00000001990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQXXXXXXXXXXXXXXXXXXXXXXKR
FRKAQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSG
PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINA
AKGSSNSYAIKKKDELERVAKSNR
Download sequence
Identical sequences ENSTTRP00000001866 ENSTTRP00000001866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]