SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001972 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001972
Domain Number 1 Region: 419-564,681-819
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.28e-45
Family Phosphate binding protein-like 0.00000000031
Further Details:      
 
Domain Number 2 Region: 208-412
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.56e-32
Family L-arabinose binding protein-like 0.0061
Further Details:      
 
Domain Number 3 Region: 618-676,710-738
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000051
Family Voltage-gated potassium channels 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001972
Domain Number - Region: 21-132
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000589
Family L-arabinose binding protein-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001972   Gene: ENSTTRG00000002098   Transcript: ENSTTRT00000002100
Sequence length 954
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3384:154112:178453:1 gene:ENSTTRG00000002098 transcript:ENSTTRT00000002100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTMRLLTLALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXSKKRNYENLDQLSYDNKRGPKAEKVLQFDPGTKNVTALLMEARELEARVI
VLSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVE
FNEDGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRMK
IVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFPYEVHLVADGKFGTQERVNNSSKSGNVMMGELLPGLADMIVVPLTFY
NERAQYIEFSKPFNYHELDFLVINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFA
MIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELS
TMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGI
GMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLV
AGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDKKKDKEEHKKKDTRGI
ASKLGSKLKKRRSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQMCARHRES
Download sequence
Identical sequences ENSTTRP00000001972 ENSTTRP00000001972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]