SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002130 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002130
Domain Number 1 Region: 298-560
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-85
Family Eukaryotic proteases 0.00000000333
Further Details:      
 
Domain Number 2 Region: 105-209
Classification Level Classification E-value
Superfamily Kringle-like 1.11e-31
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 3 Region: 213-299
Classification Level Classification E-value
Superfamily Kringle-like 1.33e-29
Family Kringle modules 0.0000351
Further Details:      
 
Domain Number 4 Region: 37-84
Classification Level Classification E-value
Superfamily FnI-like domain 1.67e-17
Family Fibronectin type I module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002130   Gene: ENSTTRG00000002270   Transcript: ENSTTRT00000002272
Sequence length 562
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_363:277698:289400:-1 gene:ENSTTRG00000002270 transcript:ENSTTRT00000002272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVKREILCVLLLCGAVFSSPSQEIHRRLRRGARSHRTCRDEKTQMTYLQHESWLRPLL
RGNRVEHCWCNGGRAQCHSVPVNSCSTPRCFNRGTCWQALYSSEFVCQCPEGFIGKRCEI
DASATCYQDQGITYRGTWSTAESGAECVNWNSSSLAMKPYSGRRPDALRLGLGNHNYCRN
PDQDLKPWCYIFKAGKYVSEFCSTPACGKEKDGDCYQGKGLAYRGTRSLTTSGASCLPWS
SMILMGKINTAWKSNAQALGLGKHNHCRNPDGDAQPWCHVLKDGQLTWEYCDVPQCVTCG
LRQYKQPQLRIKGGLFADITSHPWQAAIFVRNRRSPGERFLCGGVLISSCWVLSAAHCFQ
ERYPPNHLKVVLGRTYRLVPGKEEQTFEVEKYIVHKEFDDDTYNNDIALLQLKSDSLTCA
LESNAVRTVCLPDAGLQLPDWTECELSGYGKHEASSPFYSERLKEAHVRLYPSSRCTSQY
LFNRAVTNNMLCAGDTRSGGDQANLHDACQGDSGGPLVCMKDDHMILVGIISWGLGCGQK
GVPGVYTKVTNYLDWVRDNTRP
Download sequence
Identical sequences ENSTTRP00000002130 ENSTTRP00000002130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]