SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002134 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002134
Domain Number 1 Region: 107-255
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000114
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002134   Gene: ENSTTRG00000002281   Transcript: ENSTTRT00000002276
Sequence length 306
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1655:70511:73017:-1 gene:ENSTTRG00000002281 transcript:ENSTTRT00000002276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALTPWARYGLLVVAHLLALGLGAAVLQALGSPALQLXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGHMAPLSAGGKAF
CVVYTALGLPASLALVAALRHCLLPLLSRPGAWVAIHWQLTPARAALLQASGLGLLVAGI
FVLLPALVLWGLQGDCGMLQAIYFCFSSLSTIGLGDLLPGHDNGLHPVFYYLGQFALLGY
LLLGLLAMLLTVETFLELPQVRAMVKFFRSRGPLNAEDEGGILGQDELALSTLPPSAAAP
ERAPAC
Download sequence
Identical sequences ENSTTRP00000002134 ENSTTRP00000002134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]