SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002160 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000002160
Domain Number - Region: 146-215,379-421
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000181
Family cAMP-binding domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002160   Gene: ENSTTRG00000002304   Transcript: ENSTTRT00000002305
Sequence length 422
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1113:548098:717475:1 gene:ENSTTRG00000002304 transcript:ENSTTRT00000002305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMSSLPAAILSQMIAVSNVSPPPLLSIPSLQMPKNIDYPQLNTLCHMRGIQYSQTNILS
AHNIFMKQYPKIFLQNKTRLPKLFKEEGKRKPAEGTAESKPQQPDDSHNISSHVKKARGG
HTLYGPKTSEEKLVEFMAILKKLPIHRMLFEHNAVWKMLRTIPDLTSHLIDEHLKTLSKN
VISETWVKRSTLIGNDGFYIILKGLAPRTQIYKNLIEENESTTSFIPQSFHSFVFSEDFR
NSILAETHIPSMDPMLGQWSTFGTLEVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEIITFVAYISI
CRLQSVGVKTSRKVKKIRLVYMGQLKEKESFGEISVLQVPFTYTIVTGIDVEMAIIEDKD
LL
Download sequence
Identical sequences ENSTTRP00000002160 ENSTTRP00000002160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]