SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002211 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002211
Domain Number 1 Region: 28-513
Classification Level Classification E-value
Superfamily ALDH-like 7.07e-179
Family ALDH-like 0.0000000000000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002211   Gene: ENSTTRG00000002361   Transcript: ENSTTRT00000002360
Sequence length 518
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1200:114133:212462:-1 gene:ENSTTRG00000002361 transcript:ENSTTRT00000002360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNP
ATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVL
ATMESLNGGKPYLQAFYVDLQGVIKTLRYXXXXXXXXXXXXXXVDGDYFTFTRHEPVGVC
GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILP
GYGPTAGAAIASHVGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQG
PQIDKKQYNRILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQ
SPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences ENSTTRP00000002211 ENSTTRP00000002211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]