SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002262 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002262
Domain Number 1 Region: 294-550
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-53
Family Voltage-gated potassium channels 0.00098
Further Details:      
 
Domain Number 2 Region: 97-199
Classification Level Classification E-value
Superfamily POZ domain 5.23e-28
Family Tetramerization domain of potassium channels 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002262   Gene: ENSTTRG00000002414   Transcript: ENSTTRT00000002415
Sequence length 765
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_656:131833:139907:-1 gene:ENSTTRG00000002414 transcript:ENSTTRT00000002415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNSVCVSSFRGRQGSSKQQPVSPPQPSESPLPLPPPPPPPPPPPLQQQQQPAQPGPAAS
PAGPPAPRGPGGRRAEPCPGLPAAAMGRHGGGGGDSGKIVINVGGVRHEMYRSTLRTLPG
TRLAGLTEPEAAARFDYDPGADEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEEL
GFWGIDETDVEAYWMTYRQHRDAEEALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWRRWQPRVWALFEDPYSSRAARYV
AFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVE
GVCVVWFTFEFLMRITFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGF
LRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERI
GADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIA
MPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHSSG
SISPPPPITPPSMGVTVAGAYPPGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEE
VIEINRADPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTD
YAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Download sequence
Identical sequences ENSTTRP00000002262 ENSTTRP00000002262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]