SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002278 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002278
Domain Number 1 Region: 5-371
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.08e-65
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Domain Number 2 Region: 395-508,627-766
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.15e-64
Family Phosphate binding protein-like 0.00000000316
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000002278
Domain Number - Region: 530-622
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000877
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002278   Gene: ENSTTRG00000002432   Transcript: ENSTTRT00000002431
Sequence length 880
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2329:57381:143607:-1 gene:ENSTTRG00000002432 transcript:ENSTTRT00000002431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIFEYADGPNAQIMNAEEHAFRFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKAC
DQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYASL
SHAILDLVQYLKWRSATVVYDDSTGLIRLQELIMAPSRYSIRLKIRQLPLDSDDSRPLLK
EMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVNL
TGFRILNVDNPHVSAIVEKWSMERLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCYQR
APQMTVNSLQCHRHKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRMDFDLDIISLKE
DGLEKVGVWSPAEGLNITEVARGRGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLFGN
DRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMIKELIDHKADLAVAPL
TITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCV
LFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIG
GIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKS
KISTFEKMWAFMSSKPSALVKNNEEGVQRALTADYALLMESTTIEYITQRNCNLTQIGGL
IDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHVLKEKWWRGSGCPEEENKEASALGIQ
KIGGIFIVLAAGLVLSVLVAVGEFVYKLRKTAEREQRSFCSTMADEIRFSLTCQRRVKHK
PQPPMMVKTDAVINMHTFNDRRLPGKDSMTCSTSLAPVFP
Download sequence
Identical sequences ENSTTRP00000002278 ENSTTRP00000002278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]