SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002511 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002511
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.62e-24
Family Ribosomal L11/L12e N-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.36e-18
Family Ribosomal protein L11, C-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002511   Gene: ENSTTRG00000002678   Transcript: ENSTTRT00000002677
Sequence length 192
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2819:4541:10573:-1 gene:ENSTTRG00000002678 transcript:ENSTTRT00000002677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRATRALRKPEAGGVIRTIVRAGQAMPGPPLGPVLGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEI
ARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQRE
ADLAAQAEAAKK
Download sequence
Identical sequences ENSTTRP00000002511 ENSTTRP00000002511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]