SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002555 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002555
Domain Number 1 Region: 118-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.8e-33
Family cAMP-binding domain 0.00000117
Further Details:      
 
Domain Number 2 Region: 248-361
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-22
Family cAMP-binding domain 0.00000211
Further Details:      
 
Domain Number 3 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.88e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002555   Gene: ENSTTRG00000002726   Transcript: ENSTTRT00000002726
Sequence length 370
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3231:13778:79356:-1 gene:ENSTTRG00000002726 transcript:ENSTTRT00000002726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPAAQQLEEDDGLRGCELYVQKHGAQQVLKDCIVQLCISKPERPMRFLREHFEKLEKE
ENRQILAQQKSASQSDSHDEQVSPSPPNPMVQARHRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVMHIAGETVIQQGDEGDNFYVIDQG
EVDVYVSGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRRMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTA
SVLQRRSPGEEYVEVGRLGPSDYFAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQ
RYNSFISLTV
Download sequence
Identical sequences ENSTTRP00000002555 ENSTTRP00000002555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]