SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002574 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002574
Domain Number 1 Region: 456-707
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.12e-58
Family Eukaryotic proteases 0.0000334
Further Details:      
 
Domain Number 2 Region: 190-273
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-32
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 3 Region: 99-188
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-30
Family Kringle modules 0.00032
Further Details:      
 
Domain Number 4 Region: 281-344
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-20
Family Kringle modules 0.00039
Further Details:      
 
Domain Number 5 Region: 20-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 4.32e-17
Family Hairpin loop containing domain 0.019
Further Details:      
 
Domain Number 6 Region: 424-458
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000556
Family Kringle modules 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002574   Gene: ENSTTRG00000002747   Transcript: ENSTTRT00000002746
Sequence length 709
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2780:191070:195931:-1 gene:ENSTTRG00000002747 transcript:ENSTTRT00000002746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLPLLLLLTGFLGAPGQRSPLNDFQVLWGTELQHLLHTVGPRPWQEDVANAEECAGLC
GPLLDCRAFHYNVSSHGCQLLPWTQHSPHTRLQRSRRCDLFQKKMYVRTCIMDNGVEYRG
TVAITMGGLPCQRWSHRFPNDHKYTPTLRNGLDDNFCRNPDRDPRGPWCYTTDPAVRFQS
CGIKSCREAACLWCNGEDYRGSVDRTESGRECQRWDLQHPHPHPFEPRKFLDKSLDDNYC
RNPDGSERPWCYTADPQMKREFCDLPRCGSEAQPRREATTLNCFRGKGEGYRGTVNTTAA
GVPCQRWDAQHPHQHRFAPEKYACKDLRENFCRIPTGSAPCFTRRPGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSHGPWCYTTDPETTFDYCALRRCDDDQPPSILEPPDQVLFEKCGKRVTRLDPWRSKL
RVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSSCHGPLTGYEVWLGTLF
QDPQPGQPGLQRISMAKMVCGPSGSQLVLLKLERPATLNQRVALICLPPEWYVVPPGTKC
EIAGWGETKGTGDNTVLNIASLNVISNRECNIKHRGRVRESEMCTEGLLAPAGACEGDYG
GPLACFTHDCWVLEGIIIPNRVCARPRWPSIFMRVSVFVDWIHKVMRLG
Download sequence
Identical sequences ENSTTRP00000002574 ENSTTRP00000002574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]