SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002629 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002629
Domain Number 1 Region: 342-619
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-87
Family Eukaryotic proteases 0.00000000125
Further Details:      
 
Domain Number 2 Region: 104-199
Classification Level Classification E-value
Superfamily Kringle-like 1.64e-31
Family Kringle modules 0.00000552
Further Details:      
 
Domain Number 3 Region: 211-304
Classification Level Classification E-value
Superfamily Kringle-like 1.16e-27
Family Kringle modules 0.00000893
Further Details:      
 
Domain Number 4 Region: 45-102
Classification Level Classification E-value
Superfamily GLA-domain 1.63e-17
Family GLA-domain 0.0000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002629   Gene: ENSTTRG00000002805   Transcript: ENSTTRT00000002805
Sequence length 623
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2974:5067:33164:1 gene:ENSTTRG00000002805 transcript:ENSTTRT00000002805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGLWLPGCLALAALFSLVHSQHVFLAPQQALSLLQRVRRANSGFLEEWREGNLERE
CVEEQCSREEAFEALESPSATDVFWAKYTACESLRKPREKLIECLEGNCAEGLGMNYRGN
VSFTRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDGSITGPWCYTTLPTVQRE
ECSIPVCGQERVTVELTSNSRDFAVNLSPQSEMCIPDRGRQYQGHLAVTTHGSPCLAWAS
ERAKALSKDQDFSPAVPLVENFCRNPDGDEEGAWCYVAGEPGDFEYCDLDYCEEPVDEEV
GYGLGEEPDAAIEGRTAADTFLPFFDERTFGAGEADCGLRPLFENKLVQDKTEQELFDSY
IEGRIVEGRDAEIGLAPWQVMLFRKSPQELLCGASLISDRWILTAAHCLLYPPWDKNFTE
NDLLVRIGKHSRTSYERKIEKISMLEKIHIHPRYNWRENLDRDIALLKLRKPISFTEYVH
PVCLPDKDTATKLLRAGYKGRVTGWGNLRETWTANIAEVQPSVLQVVNLPIVERPVCKAS
TRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGK
YGFYTHVFRLKKWIQKVIERFGS
Download sequence
Identical sequences ENSTTRP00000002629 ENSTTRP00000002629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]