SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002739 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002739
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.57e-25
Family NadC N-terminal domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 109-177
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.04e-17
Family NadC C-terminal domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002739   Gene: ENSTTRG00000002922   Transcript: ENSTTRT00000002920
Sequence length 178
Comment pep:novel scaffold:turTru1:scaffold_96575:351:884:1 gene:ENSTTRG00000002922 transcript:ENSTTRT00000002920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALLLPPATLAALAESWLREDCPGLNHMALVTGAASSQAVLWAKSPGVLAGRPFFDAIFA
QVNCQVSWFLPEGSKLVPVAKVAEVRGPVHYLLLGERVALNMLARCSGVASAAAAAVETA
RGTGWAGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHIVAAGGVEK
Download sequence
Identical sequences ENSTTRP00000002739 ENSTTRP00000002739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]