SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002825 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002825
Domain Number 1 Region: 134-248
Classification Level Classification E-value
Superfamily C-type lectin-like 7.04e-30
Family C-type lectin domain 0.00000454
Further Details:      
 
Domain Number 2 Region: 104-129
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000373
Family Triple coiled coil domain of C-type lectins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002825   Gene: ENSTTRG00000003011   Transcript: ENSTTRT00000003010
Sequence length 248
Comment pep:novel scaffold:turTru1:scaffold_94309:53494:56057:-1 gene:ENSTTRG00000003011 transcript:ENSTTRT00000003010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLCSLTLTLIWMVVSGLDYNMKEVCLGSPGTPGTPGSHGLPGRDGRDGIKGDPGPPGPM
GPPGGMPGPPGRDGMIGAPGLTGERGEKGEPGERGPPGLPPYLDEELQSTLLEINHQILK
MTRVLSLQGSMLAVGEKVFATSGQSVNFDAIRESCARAGGRIATPRSLEENEAIANIVKK
HNTYAYLGLTEGPTAGNFHYLDGNPVDYTNWYPGEPGGWGKEKCVEMYTDGRWNDKNCLQ
SRLAICEF
Download sequence
Identical sequences ENSTTRP00000002825 XP_019781345.1.83887 ENSTTRP00000002825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]