SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002836 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002836
Domain Number 1 Region: 1218-1478
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-35
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 159-293,342-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-30
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 523-738
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-29
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 928-1053,1093-1171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-26
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000002836
Domain Number - Region: 1483-1630
Classification Level Classification E-value
Superfamily EF-hand 0.0239
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002836   Gene: ENSTTRG00000003019   Transcript: ENSTTRT00000003021
Sequence length 2195
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2905:193262:445889:1 gene:ENSTTRG00000003019 transcript:ENSTTRT00000003021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNENTRMYIPEENHQGPSYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTMATRPPRALLCLTLKNPIRRACISI
VEWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERVEYLFLIIFTVEAFLKVVA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGLDEEKPRNMSMPTSETESVNTENVA
GGDIEGESCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSSVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
TASPEKRQEVVEKPAVEETKEEKIELKSITADGESPPATKINMDDLQPNENEDKSSYPNL
ETTGDEEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILFYFDIVFTTIFTIEIALKMTAYGAFLHK
GSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQC
VFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYVTYKDGEV
DHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVE
ISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRR
YIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGL
FTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENS
RISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQV
FGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGSSA
EGEAPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIW
AEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNAT
LFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYAT
FLIQEYFRKFKKRKEQGLVGKPPQRNALSLQAGLRTLHDLGPEIRRAISGDLTAEEELDK
AMKEAVSAASEDDIFRRAGGLFGNHVGYYPSDSRSTFPQTFTTQRPLHISKAGTSQGDAE
SPSHEKLVDSTFTPSSYSSMGSNANINNANNTALGRCPCPAGQPGAVSISTVEGREPPLS
PAVQVQGASWRLSSQRTHCHDVLGGQRLLPALGLSVPHLYQQLQAGPGGSEHFTLSCPSA
GQQPPAAPFLGQTCPSRDSLIAMVCQDEAPRDETCGLRMDEDAEYGSEPSLICTEMLSYQ
DDENRQLAPPEEDRRDIHLSPKRGFLRSASLGRRASFHLECLKRQKNPGGDISQKTVLPL
HLVHHQALAVAGLSPLLQRSHPPGALPPPHATPPATPGPAWPLRPVPTLRLEGAESSDKL
TSSFPSVHCGPWAGEPTPCGASGGIRRARPVSLTVPSPAGPQGRPFHGSASSLVEAVLIS
EGLGQFAQDPRFLKATTQELADACDMTIEEMESAADNILSGGARQSPNGTLLPCAHCRDP
GPDREGGAEDAAWAPAPSRQGGEEPRDSRAFASSL
Download sequence
Identical sequences ENSTTRP00000002836 ENSTTRP00000002836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]