SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002837 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002837
Domain Number 1 Region: 232-364,407-541,649-760
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.69e-27
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Domain Number 2 Region: 653-724,776-908
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000675
Family YVTN repeat 0.045
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000002837
Domain Number - Region: 1009-1086
Classification Level Classification E-value
Superfamily EF-hand 0.00682
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002837   Gene: ENSTTRG00000003022   Transcript: ENSTTRT00000003022
Sequence length 1135
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_787:27172:91351:1 gene:ENSTTRG00000003022 transcript:ENSTTRT00000003022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDAEENPLEETEEYGEIEMEEEEEKYPNDEGLENMQQELKEDNTLAWRGSQEEGEAERE
GAEGKEEGEEFGKEEAAGAHEETTVKPQEITKSMISLERLTPTDSQSILSGTLPKTYSGR
ESKHSLQSELLETFELPSMASQLEFLDLDLTTSAEQQLSSPEKQPSGELAERTDQRPQDE
LGQERRDLEPEKREGRKETRVLYVQPKARIPKGSLVSTATEDILFQKDDGANVYPLAMTW
SFGWNSSLPVYYIQDENQRVLLYASANTAVIYNVFKNNQHHLQGHPNVISCLCISEDRRW
VATADKGPECLIIIWDCFTGIPVHTIFDSCPEGGGIRAMAITHDAKYLATISDAEIQKVC
IWRWTLAVETPACTLNLPKEYGFQSYLTFNPTNNKELVSNSKTQAIYYMWYEEGDILVHS
APLLTEKTFNKLVGKFSQSVFHLNLTQILSATMEGKLVVWDIYRPPPSASTSLGFPHITP
CKLVHLQKEGITVLTTVDSYVVTGDIRGNIKFYDHTLSIVNWYSHFKLSSIRSLSFSKTP
ATPPTENTNYPPDYTLKGDLFIVRNFIIGTSDASVYHTADGTKLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALLGAGFTEGTVY
ILDAMSLESETPEPFKYSRTSVTHVSFSHDSQYMATADVSFTVAVYVVRVKNGRRVWEYL
ARLRSHRKSIRSVLFGVHLDSNEPRLLSLGRDRLLIEYNLLKSYKDHLEVLDIQRTDQGS
YPTCMVWYPPLTKELFLLICNSGYKVKLFNSTTKMCRKTLLGPVYGSPIEQIQILPVKTP
LELQKRYMVFINRDKVGLQILPVDGNPHKTSALICHPSGAAGMDVSYDGRYTFTAGGQDR
SVVQWEINLSALEAAVSLGGEDLTPFYGLVSGXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXIEDMFNEIRFSEYVDTGKLIDKINLPDFFKVY
LNHRPPFGNTMSGIQRSFDILGFTNSKGKKAIRREDFLKLLQTKGEHMTEEEMSDCFATL
FGLNPEGWKSEPAASSVKGSEICFEEELPDEITAEIFTTQILGLTISQDSGQDGQ
Download sequence
Identical sequences ENSTTRP00000002837 ENSTTRP00000002837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]