SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002938 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002938
Domain Number 1 Region: 10-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.19e-24
Family Ankyrin repeat 0.00072
Further Details:      
 
Domain Number 2 Region: 347-388
Classification Level Classification E-value
Superfamily LEM domain 0.0000000432
Family LEM domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002938   Gene: ENSTTRG00000003135   Transcript: ENSTTRT00000003135
Sequence length 603
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1261:188588:192290:1 gene:ENSTTRG00000003135 transcript:ENSTTRT00000003135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSATVLARRLQAALRKEELRAVEELLRRGADPNLVLEDGAAAMHLAARAQRPRSLCCLE
ALLRRGGDPNTRSAEALTPLHVAAAWGCRRGLELLLSQGADPALRDQDGLRPVDLAEQQG
HQNCVRVLRELEARTRTPTRTRADPQEPEPEPKPGTPGPSGPPSVTLDSTTLGRGDDKDM
SLEAGPGPPSLLAHPEIAGTDGSLESPLGCWDCSSVASFVTAVEASGAEDPTAHMSPWAG
RPSQRVPLRVPHSTSSPQDREAELNARLQALTLTLPDASPSPKFFPERSPAHSAPWEPLP
GPSDLHIPKDDQLSLDSDVAALWLTEDEASATGGRDPITSCQCPPDPTTSDLELLQGLRA
LGKSRGPITSFTRPYYLQPLEEAQAARGLEFSGHSPELAKALRTGRIPDAQADEDALAKQ
FEQPEPTRRWREGVMKSSFTYLLLDPRKTQNLPARAFSLTLAECLRIFVHAIFYVGKGTR
TRPNVHLWKALSHRGWPGKQPPQACPKVRQILDIWASGRGVVSLHCFQHVVAVEAYTREA
CLVDALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLAEGERELWPQDIQ
ARG
Download sequence
Identical sequences ENSTTRP00000002938 ENSTTRP00000002938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]