SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002943 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002943
Domain Number 1 Region: 104-184,251-441
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.78e-36
Family G proteins 0.00043
Further Details:      
 
Domain Number 2 Region: 254-283,451-522
Classification Level Classification E-value
Superfamily TrmE connector domain 1.7e-18
Family TrmE connector domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002943   Gene: ENSTTRG00000003140   Transcript: ENSTTRT00000003140
Sequence length 522
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1261:228521:231591:1 gene:ENSTTRG00000003140 transcript:ENSTTRT00000003140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLWTLVARAARGPRRPCTRQGSGAPAPGSGATVFALSSGQGRCGIAVIRTSGPASGQ
ALRSLTAPRDLPPARKACLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCAEFHVHGGPA
VVSGVLQALGSVPGLRPAEAGEFTRRAFAHGKLSLTEVEGLADLIHAETEAQRRQALRQL
DGELSHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGVLDRGGSACPGAWEVGTFHLSPP
RSLLPLFPPSTADSEVRELEVALGAHLRDARRGQRLRSGAHVVVAGPPNAGKSSLVNLLS
RKPVSIVSPEPGTTRDVLETPVDLAGFPALLSDTAGLREGVGPVEQEGVRRAQKRLEQAD
LILAVLDASDLASPSSCNFLDTVVIPAGAGSPNGRSQRLLLVLNKSDLLPAGGPDPSADL
PPYLLLSCLTGEGLDGLLEALRKELAALCGDPSTGPPLLTRARHQHHLQGCLDALGHYKQ
AKDLALAAEALRVARGHLTRITGGGGTEEILDIIFQDFCVGK
Download sequence
Identical sequences ENSTTRP00000002943 ENSTTRP00000002943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]