SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002956 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002956
Domain Number 1 Region: 43-229
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 2.49e-40
Family PaaI/YdiI-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002956   Gene: ENSTTRG00000003153   Transcript: ENSTTRT00000003153
Sequence length 238
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1693:128428:165744:-1 gene:ENSTTRG00000003153 transcript:ENSTTRT00000003153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSCTAALRTLRALRGRREGRPPLRDPVLVRRWFSTEKVIPKDYALPNPSWSKDLRLLF
DQFMKKCEDGSWERLPSYKSKYTQKSEDFKTYFLDSKLVKEQLSQAQLFTRGYEDGLGFE
YVIFYNDDEKRTVCLFQGGPYLQGVPGFLHGGAIATMIDATVGMCAAIPGGIVMTANLNI
NFKRPIPLCSVVVINSQLDKIEGRKFFLSCTVRSVDEKILYSEATGLFIKLDPEKSLI
Download sequence
Identical sequences ENSTTRP00000002956 ENSTTRP00000002956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]