SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003055 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003055
Domain Number 1 Region: 363-770
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-90
Family ALDH-like 0.000000123
Further Details:      
 
Domain Number 2 Region: 71-353
Classification Level Classification E-value
Superfamily Carbamate kinase-like 1.15e-50
Family PyrH-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003055   Gene: ENSTTRG00000003259   Transcript: ENSTTRT00000003258
Sequence length 795
Comment pep:known_by_projection scaffold:turTru1:scaffold_109940:62913:105105:-1 gene:ENSTTRG00000003259 transcript:ENSTTRT00000003258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRVCRSGSPSFTHRLLPWVQSTTLSRSCCVQPSAIRHVRSWSNIPFITVPLSRAHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDNPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAG
PTVEQQGEMARSGGRMLATLEPEHRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAA
PLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKDLELEQVTVPFGVLLVIF
ESRPDCLPQVAALAIASGNGLLLKGGKEASHSNRILHLLTQEALSIHGIKEAVQLVNTRE
EVEDLCRLDKMIDLIIPRGSSQLVRNIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRL
VRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSE
VKSLRTEYGDLELCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVF
WNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSL
KYLHENLPVPQRSTN
Download sequence
Identical sequences ENSTTRP00000003055 ENSTTRP00000003055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]