SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003060 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003060
Domain Number 1 Region: 154-267
Classification Level Classification E-value
Superfamily DNA clamp 0.000000408
Family DNA polymerase processivity factor 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003060
Domain Number - Region: 27-99
Classification Level Classification E-value
Superfamily DNA clamp 0.00589
Family DNA polymerase processivity factor 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003060   Gene: ENSTTRG00000003263   Transcript: ENSTTRT00000003263
Sequence length 278
Comment pep:known_by_projection scaffold:turTru1:scaffold_92856:52916:57986:1 gene:ENSTTRG00000003263 transcript:ENSTTRT00000003263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQQIPDENDYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQA
NAFIQAGIFQEFRVQEESVTFQINLNILLDCLSIFGSSPMPGTLTALRMCYQGYGYPLML
FLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITM
SPDKPYFRLSTFGNASSHLDYEDSDLMESFHCNQTQVNXXXXXXXXXXXXXXXXSCKVSI
RTDNRGFLSLQYMIRNEDGQICFVEYYCCRDEEVRESS
Download sequence
Identical sequences ENSTTRP00000003060 ENSTTRP00000003060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]