SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003062 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003062
Domain Number 1 Region: 315-404
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 141-193
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000628
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 36-95
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000837
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003062   Gene: ENSTTRG00000003266   Transcript: ENSTTRT00000003265
Sequence length 907
Comment pep:known_by_projection scaffold:turTru1:scaffold_110410:132883:900010:1 gene:ENSTTRG00000003266 transcript:ENSTTRT00000003265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKL
LPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEGPPPNTSVKVIGAQRRRS
PSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDY
VHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDAASSASSSSQSETPEPVESTSPSLLTTDN
TLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAHA
LPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVEG
IRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNPE
YKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNENSKSDEKGNQSENSEDPE
PDRKKSGNTCDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAAEDGGGFGALGPMQI
KVERYVESESDLRLQNCESLSSDSAKDSDSAGEAGAQASSKHQKRKKRRKRQKGGSASRR
RLSSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDNDSSIWNYPPNREISR
NESLYSMTKPLSSEHFLSLPGGAGGGGLHVAIPDSVLTPPGADGAAARKTQFGTSAPAAL
APVASDPLSPPLSASPRDKHPGGGSSGGGSGPGASNSLLYTGDLEALQRLQAGNVVLPLV
HRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQGNLLPNAHAVNFVDVNSPGFGLDPK
TPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPTGNVFTTAEGLFSTLPFPVYSNGIHAAQ
TLERKED
Download sequence
Identical sequences ENSTTRP00000003062 ENSTTRP00000003062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]