SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003160 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003160
Domain Number 1 Region: 34-571
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.35e-141
Family Aconitase iron-sulfur domain 0.0000000000000114
Further Details:      
 
Domain Number 2 Region: 578-797
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 7.85e-65
Family LeuD-like 0.00000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003160   Gene: ENSTTRG00000003371   Transcript: ENSTTRT00000003371
Sequence length 802
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_501:318354:370843:1 gene:ENSTTRG00000003371 transcript:ENSTTRT00000003371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPYNLLVTRLQKALGVRQYHVASVLCQRAEVAMSHFEPTEYIRYDLLEKNINVVRKRLN
RPLTLSEKIVYGHLDDPAHQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAV
PSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLASAGAKYGVGFWRPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGIDSISCTGEEGGHVTWLSACAGPNGPVVE
RRSSMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHYD
QLIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGR
SAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQW
DRKDIKNGENTIVYNTXXXXXXXXXXXXXXXXXXXXIVTALAIAGTLKFNPDTDFLTGKD
GKKFKLEAPDADELPRAEFDPGQDTYQHPPKSSGQRVDVSPTSQRLQLLEPFDKWDGKDL
EDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQE
FGPVPDTARYYKAHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNL
KKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFN
ETQIEWFRAGSALNRMKELQQK
Download sequence
Identical sequences ENSTTRP00000003160 ENSTTRP00000003160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]