SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003194 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003194
Domain Number 1 Region: 12-363
Classification Level Classification E-value
Superfamily UROD/MetE-like 8.2e-116
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003194   Gene: ENSTTRG00000003406   Transcript: ENSTTRT00000003406
Sequence length 367
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1669:238344:242031:1 gene:ENSTTRG00000003406 transcript:ENSTTRT00000003406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANECGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPETCCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLQR
LRDPTTVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRW
LYQRPQASHQLLRILTDALVPYLVGQVAAGAQALQLFESHAGHLGPQLFSKFALPYIRDV
AKRVKAGLQEAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPEKARDCVGKTVT
LQGNLDPCALYASEEEIGQLVQQMLNDFGPRRYIANLGHGLYPDMDPEHVGAFVDAVHKH
SRLLRQN
Download sequence
Identical sequences ENSTTRP00000003194 XP_004266339.1.21590 XP_007450419.1.90284 ENSTTRP00000003194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]