SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003240 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003240
Domain Number 1 Region: 403-573,606-702
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 3.53e-59
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00046
Further Details:      
 
Domain Number 2 Region: 1116-1172
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.44e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 3 Region: 702-745
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000863
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003240   Gene: ENSTTRG00000003455   Transcript: ENSTTRT00000003455
Sequence length 1172
Comment pep:novel genescaffold:turTru1:GeneScaffold_2266:150965:240412:1 gene:ENSTTRG00000003455 transcript:ENSTTRT00000003455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTNPGNWVTFDDDPAFQSSQKSKNFPLENQGICRPNGLKLNLSGTKEFPSGYSSTSST
PLSSPIIDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPESSSNSPLIPGAGS
SILPTKPTCLSNASLLSDHSCIHPAPKVGLPDEMSPHQAESLGFQSDTPQFQYFQEDCAF
SSPFWKDEGSASQLTFDPPGSRKMVPSRDKEMPIDQKALNQCSLNYICEKLEHLQSAENQ
DSFGNLSTQYLYAEDAASSFVPHMLFRSQPKAGWSFMLRIPEKKNVMSSRQWGPIFLKVL
PGGILQMYYEKGLKPFKELQLNPYCRLSEPKVENFSVTGKIHTVKIEHVSYTEKRKYHSK
TEVVHEPDIEQMLKLGSTEYHDFLDFLTSVEEELMKLPAVSKPKKNYEEQEVFLEIVDNF
WGKITKEEGKLVESAVITQIWCLCFVNGNTECFLTLNDLELQKRNECYFEKDPEKKGIDI
LDYHFHKCVNAQEFEQSRIIKFVPLDACRFELMRFKTLYSGEDLPFSLKSVVVVQGAYVE
LQAFVNMAPLVQRPSLRSCDNIMIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSL
HEPESEPVIQVTVGSAKYESAYRAVVWKIDRLPDKNSSPDHPHCLSYKLELGSDQEIPSD
WYPFATVQFGILDTCASRTEVRSLGVESDVQPQKHVHQRACYNIQPKLYRSVIEDVIEGV
RDLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNGVHLPLFTLQLPHSLHQTLQSST
ASLLIPAGKTLPTFTTAELGTSNSSANFTFPGYPVHVPXXXXXXXXXXXXYKVNVPIMVT
QTGRASIQHPFQQVSQQLGQSIIQTNIPQLNPWCLQVTTEKSQRMETVLQQPVVLRSGTV
DRKRLENATGDTLLHPGNQHKIMSEALLSQPENSQYISLSGVVFPPQLSQMDSNVEPVLG
VSASMTQNLHGGPLSTGPQGAQHQHTPDVQLRVLKDRMCGWDSVKQPRNTEEPSSLPVSK
KDSNSQMDLSLQVTDDDINEIIQIDGTGDTASSDEIGSTRDVDENKFLGITDAGDLKVFE
EASSISNEDSMANSSDNEDPQVDLVEEDPLNSGDDVSEQDVPDLFDTDNVIVCQYEKIHR
SKNKWKFYLKDGIMCFGGRDYVFAKAVGDAEW
Download sequence
Identical sequences ENSTTRP00000003240 ENSTTRP00000003240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]