SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003295 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003295
Domain Number 1 Region: 1475-1725
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-32
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 2 Region: 88-246,288-358
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-32
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 3 Region: 472-649
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-28
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 1180-1312,1349-1426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.53e-25
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003295   Gene: ENSTTRG00000003504   Transcript: ENSTTRT00000003515
Sequence length 2310
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3372:207201:496017:1 gene:ENSTTRG00000003504 transcript:ENSTTRT00000003515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSRILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTLARSIKSTKVDGALLRHKERLLRISIRHMVKSQVFYWIVL
SLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCF
DFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSI
ISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLLNVFLAIAVDNLANAQELTKDEQEEEEAF
NQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTS
QLRRHMQMPSQEALNKEEAPPMNPLNPLNPLSSLHPLNAHPSLYRRPRPIEGPALGLGLE
KCEEERVSRGGSLQGDGGDLSSALDNQRSPVSLGKREPPWLARPCHGNCDPTQQEAGGGE
TVVAFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAVPSEGERDLEPR
DSHGGKEPTIQEEERSQDLRRTNSLMVHRRSGLAGALDEANTPLALPQPELQAEKDAALT
EQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCTTANTDRAAPESTSVTIAIPDVDPLVD
STVVHISSKTDGEASPLKEAEIKEDEEEVEKKQQKKEKRETGKAMVPHSSMFIFSTTNPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLRYFDYVFTGVFTFEMV
IKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGSNKGRDIKTIKSLRVLRV
LRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSS
KDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSV
DVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKN
ERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSA
PCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDS
KLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYA
IIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDT
TAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLD
EFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMT
VHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKSDL
TVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQ
DPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQPSNHGI
YLPPDTQEHAGSGRASSMPRLTVDPQVVTDPSSIRRSFSTIREKRSNSSWLEEFSMERSS
ENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSE
ERGTQADWESPERHQSRSPSECRSQTSNRPGTGSLSESSIPSVSDTSTPRRSRRQLPPVP
PKPRPLLSYSSLIRHTGSISPPADGSEGGSPLTSQALEGNDASLPEPCNPRYVQQGHPSS
PQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHY
RRRRHGGPGPGMMCGAVSDLLSDTEEDDKC
Download sequence
Identical sequences ENSTTRP00000003295 ENSTTRP00000003295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]