SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003322 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003322
Domain Number 1 Region: 46-151
Classification Level Classification E-value
Superfamily FKBP-like 1.39e-42
Family FKBP immunophilin/proline isomerase 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003322   Gene: ENSTTRG00000003547   Transcript: ENSTTRT00000003544
Sequence length 152
Comment pep:novel scaffold:turTru1:scaffold_95332:20615:41927:1 gene:ENSTTRG00000003547 transcript:ENSTTRT00000003544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRSRSAEGRGTAAEPPPDRSLSTPPVAPAVAPPARPASAAAAAAMGVQVETISPGDGRTF
PKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWEEGVAQMSVGQRAKLT
ISPDYAYGATGHPGIIPPNATLVFDVELLKLE
Download sequence
Identical sequences ENSTTRP00000003322 ENSTTRP00000003322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]