SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003560 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003560
Domain Number 1 Region: 1-315
Classification Level Classification E-value
Superfamily ALDH-like 3.14e-76
Family ALDH-like 0.0000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003560   Gene: ENSTTRG00000003786   Transcript: ENSTTRT00000003788
Sequence length 351
Comment pep:novel genescaffold:turTru1:GeneScaffold_376:49083:52269:-1 gene:ENSTTRG00000003786 transcript:ENSTTRT00000003788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPGLIIAPWNYPYLSLVPLVGALAAGNCALLKPSEVSESTEKVLAEVLPRYLAQSCFAV
VLGGPEETRQLLEHKFDYILFTRGPRVGKVVMAAAAKHLTPVTLELGGKNPCYVDDNCDP
QTVANRVAFFRYFNSGQTCVAPDYILCSPEMARLLLALQSAITRFYGEDPQSSPDLGRII
SEIFQRLRGLLSCGHVAIGGQTDESDRYIAPTVLVGVQETEPVMREEIFGPILPIMNVRS
LDEAIEFIRCREKPLALYAFSNSSQRISSGPFGGKEGFIYPTLPSLPLGGVDNSGGSYHS
KFSFDAFSHHRACLLCPSGLEKLKDILYSPFSACTQQLLSWALGNQRCLLL
Download sequence
Identical sequences ENSTTRP00000003560 ENSTTRP00000003560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]