SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003584 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003584
Domain Number 1 Region: 1474-1664,1698-1723
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-38
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1187-1423
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-35
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 126-271,338-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.16e-32
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 742-888,922-968
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.39e-27
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003584
Domain Number - Region: 1731-1777
Classification Level Classification E-value
Superfamily EF-hand 0.00441
Family Calmodulin-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003584   Gene: ENSTTRG00000003797   Transcript: ENSTTRT00000003813
Sequence length 1947
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2589:9418:92813:-1 gene:ENSTTRG00000003797 transcript:ENSTTRT00000003813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMLPPPGPQSFVYFTKQSLALIEQRIAEGKTKEPKEEKKDDDEEGPKPSSDLEAGKQLP
FIYGDIPQGMVSEPLEDLDPYYADKKTFIVLNKGKAIFRFNATPALYILSPFSPLRRISI
KILVHSTAFSMLIMCTILTNCIFMTMSNPPDWTKNVEYTFTGIYTFESLVKILARGFCVG
EFTFLRDPWNWLDFIVIVFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALI
QSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKQKCVRTLLENNETIESILNTLEDYGKY
FYYLEGSKDALLCGFSTDSGQCPEGYTCVKVGKNPDYGYTSFDTFSWAFLALFRLMTQDY
WENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEARQKELE
FQQMLDRLKKEQEEAEAIAMAAAEYTSIERSRIMGLSESSSETSKMSSKSAKERRNRRKK
NNQKKLSIGEEKGDDEKLSKSESEESIRRKSFHLGVEGHRRAREKRFSTPNQSPLSIHGS
LFSARRSSRTSLFSFKGRGKDIGSETEFADDEHSIFGDNESRRGSLFVPHRPWERRSSNI
SQASRSPPGLPVNRKMHSAVDCNGVVSLVDGPSALMLPNGQLLPEVIIDKATSDDSGTNN
QIHKKRRSSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHTFL
IWNCSPYWIKFKRLIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTDEFKNVLTVGNLF
TGIFAAEMVLKLIAMDPYEYFQVRWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLLRVF
KLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINEDC
TLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVINLVVLNLFL
ALLLSSFSSDNLTAIEEDTDANNLQTAVARIKKGINYVKQTLREFFLKGFSTKPKISKEI
RRTEDLNYKKENYISNHTLAEMSKDHNFHKEKDKTSGFGNSMDKYLVEESDCQSFIHNAS
LTVTVPIAPGESDLEIMNTEELSSDSDSEYSKGRLNGSSSSECSTVDNPVPGEGEEAEAE
PVNSDEPEACFTDGCVQRLPCCQVNTESGKGKIWWNIRKTCYRIVEHSWFESFIVLMILL
SSGALAFEDIYIEKKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCWLDFL
IVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNV
LLVCLIFWLIFSIMGVNLFAQVLQCVNTTDGHRFLQVVENVATFKGWMVIMYAAVDSVNV
DRQPIYEYSLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKY
YNAMKKLGSKKPQKPIPRPGNKFQGCIFDLVTNQAFDIAIMVLICLNMVTMMVEKEGQSA
YMTEVLYWINVVFVILFTGECVLKLISLRCYYFTVGWNIFDFVVVILSIVGMFLADLIER
YFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIF
GMSNFAYVKKEAGINDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPRKVH
PGSSVEGDCGNPSVGIFYFVSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEM
FYEVWEKFDPDATQFIEYSKLSDFAAALDPPLLVAKPNKVQLIAMDLPMVSGDRIHCLDI
LFAFTKRVLGESGEMDSLRSQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYR
RYRLRQNVKNISSIYIKDGDRDDDLPNKEDMVFDNVNENSSPEKTDGTPSTISPPSYDSV
TKPDKEKYEKDKTEKEDKGKDGKEGKK
Download sequence
Identical sequences ENSTTRP00000003584 ENSTTRP00000003584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]