SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003666 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003666
Domain Number 1 Region: 927-1202
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.36e-55
Family Patatin 0.049
Further Details:      
 
Domain Number 2 Region: 591-709
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.45e-22
Family cAMP-binding domain 0.0083
Further Details:      
 
Domain Number 3 Region: 474-593
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.02e-19
Family cAMP-binding domain 0.0057
Further Details:      
 
Domain Number 4 Region: 141-277
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000311
Family cAMP-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003666   Gene: ENSTTRG00000003890   Transcript: ENSTTRT00000003895
Sequence length 1308
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_637:97103:118135:1 gene:ENSTTRG00000003890 transcript:ENSTTRT00000003895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPLQTGMVLGVMIGAGVAVLVTAVLILLLVRRLRVPKTPAPDGPRYRFRKRDKVLFYG
RKIMRKVSQSTSSLVDTSVSTTSRPRMKKKLKMLNIAKKILRIQKEAPTLQRKEPPPAVL
EADLTEGDLANSHLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLSQGDYVFRPGQP
DASIYVVQDGLLELCLPAPXXXXXXXXXXXXXXXXXXXXXXXXXXXGHQHPQRTVSARAA
RDSTVMRLPVEAFSAVFTKYPESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQP
LRLFPSPGLPARTSPVRGSKRIASTSASEEARETPGRPPDPTGAPLPATAGDPVKPTSLE
APSAPLLSRCISMPVDISGLQGGPRSDFDMAYERGRISVSLQEEASWGPQAALARTPTQE
PREQPAGACEYSYCEDESATGGCPFGPYQGRQTSSIFEAAKRELAKLMRIEDPSLLNSRV
LLHHTKAGTIIARQGDQDVSLHFVLWGCLHVYQRMIDKAEDVCLFVVQPGELVGQLAVLT
GEPLIFTLRAQRDCTFLRISKSDFYEIMRAQPSVVLSAAQTVAARMSPFVRQMDFAIDWT
AVEAGRALYRQGDRSDCTYIVLNGRLRSVIQRGNGKKELVGEYGRGDLIGVVEALTRQPR
ATTVHAVRDTELAKLPEGTLGHIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPAGSGLG
VPPHSELTNPASNLATVAVLPVCAEVPMVAFMLELQHALQAIGPTLLLNSDIIRARLGAS
ALDSIQEFRLSGWLAQQEDTHRIVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQ
LEQMLENTAVRALKQLVLLHREEGPGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAK
LHELYEKVFSKRADRHSDFSRLARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVD
LVGGTSIGSFIGALYAEERSASRTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNR
SIHRVFQDKQIEDLWLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKD
GHLLMDGGYINNLPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWA
DKIKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQ
YGKAVFGGWTRGDIIEKMLTDRRSADLNESRRADVLAFPSSGFTDLAEIVSRIEPPTSYV
SVSDGCADGEESDCLTEYEEDVGPDCSRDEGGSPEGASPSTASEMEEG
Download sequence
Identical sequences ENSTTRP00000003666 ENSTTRP00000003666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]